Products Companies Industry News Selling leads Inquiries UC Center
Home > Telecommunications > Walkie Talkie >

pharmaceutical human growth hormone

Refine Search

Business Type

Region

Quality Control

pharmaceutical human growth hormone

Found 2514 pharmaceutical human growth hormone for sale from different pharmaceutical human growth hormone manufacturers, This page shows 1 - 21 pharmaceutical human growth hormone products.
Trenbolone Enanthate Cutting Cycle Steroid Raw Powders For Muscle Growth 472-61-546 Trenbolone Enanthate Alias: Revalor-H CAS No: 472-61-546 Einecs No: 233-432-5 MF: C20H24O3 MW: ... 2016-11-21
Steroidraws Health Tech Company Limited Verified Supplier  Supplier capability assessment
Pharmaceutical Mass Building Supplements HGH Human Growth Hormone Generics 191aa(Jin hgh) 10iu vial Quick Details: Product name: Human Growth Hormone Trade name: Generics 191aa ... 2015-08-05
USPSTAR Technology Co.,Limited Verified Supplier  Supplier capability assessment
Sermorelin Acetate SARMs Steroids For Anti Aging Human Growth Hormone Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser... 2016-12-09
Wuhan Yuancheng Technology Development Co., Ltd. Verified Supplier  Supplier capability assessment
Body Building Human Growth Hormone Steroid HCG 99.5% Purity Applications: Body building Anti-aging Fat loss Get taller Specifications: Brand Name: human growth hormones Place of ... 2015-10-20
Zhuhai jiacheng Sci. & Tech. Co., Ltd Verified Supplier  Supplier capability assessment
Polypeptide Hormones Fragment 176-191 of HGH/ Human Growth Hormone for fat burning Notice: We do not sell finished polypeptide, HGH and HGH Fragment 176-191 is diffierent product, ... 2016-07-14
Zhuhaishi Shuangbojie Technology Co.,ltd Verified Supplier  Supplier capability assessment
Getropin human growth hormones natural bodybuilding supplements greater cardiac output Quick Detail: Brand Name: human growth hormones Place of Origin: China Purity : 99.5% Color : ... 2016-05-12
HongKong Amgen Biopharm CO.,LTD Verified Supplier  Supplier capability assessment
Bodybuilding Human Growth Hormone Hygetropin 100IU Kit For Muscle Growth Quick Details : Hygetropin Purity (HPLC): 99.8%. Appearance: Liquid Grade : Pharmaceutical Grade Storage: ... 2016-06-29
Shenzhen RuiJin Pharmaceutical Co.,Ltd Verified Supplier  Supplier capability assessment
8iu /10iu Natural Human Growth Hormone Supplements Steroid Hormones Product Name:Human Growth Hormon Hygetropin Purity (HPLC): 99.2%. Hygetropin Appearance:White Powder Hygetropin ... 2016-09-18
Hubei Holy Biological Co., Ltd. Verified Supplier  Supplier capability assessment
Pharmaceutical Grade Jintropin HGH Kigtropin HGH Hygetropin HGH Somatropin HGH Human Growth Hormone Warehouse in USA Specification: Product name HGH Human Growth Hormone Form & ... 2016-11-29
Shenzhen Ghormone Biotech Co.,Ltd Verified Supplier  Supplier capability assessment
GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 CJC-1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl... 2016-11-16
Jinan  Jia  Ge  Biological  Technology  Co., Ltd. Verified Supplier  Supplier capability assessment
L-163191 Nutrobal Ibutamoren Mesylate Drug Human Growth Hormone HGH CAS159752-10-0 Description: MK-677 is an oral SECRETAGOGUE that provides higher amplitude to the dozen or more ... 2016-11-29
Wuhan Lianshangwang Technology Co.,LTD Verified Supplier  Supplier capability assessment
GHRP-6 Human Growth Hormone Somatropin With Secretagogue / Ghrelin Mimetic Brief info: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 ... 2016-11-16
Zhuhaishi Shuangbojie Technology Co.,ltd Verified Supplier  Supplier capability assessment
Fat Loss Peptide White Human Growth Hormone Powder HGH Fragment 176-191 2mg/Vial Quick Detail: HGH fragment 176-191 Synonyms:HGH Fragment 176-191 MF: C78H123N23O23S2 MW: 1815.08152 ... 2016-12-23
Shanghai Shucan Industrial Co.,Ltd Verified Supplier  Supplier capability assessment
Human Growth Hormone Peptides Cosyntropin Tetracosactide CAS 16960-16-0 Quick Details: * Product name: Cosyntropin/ Tetracosactide * Synonyms: Cosyntropin/ Tetracosactide * CAS No.... 2016-11-08
Wuhan Yuancheng Technology Development Co., Ltd. Verified Supplier  Supplier capability assessment
CAS 1255-49-8 Phenylpropionate Steroids Testosterone Testolent Human Growth Hormone 1.Quick Detail: 1: Alias: Retandrol 2:Manufacturer :NJBN STEROIDS 3.Assay:98%min 4.Package... 2016-11-11
Nanjing Bangnuo Biotechnology Co., Ltd Verified Supplier  Supplier capability assessment
Pharmaceutical Human Growth Hormone Peptide TB-500 Anti Inflammatory Basic Information: TB500 Appearance: White powder TB500 CAS No.: 77591-33-4 TB500 Molecular Formula: C212H350N5... 2016-08-13
Please input your companyname!
98% Polypeptide Hormones Alarelin Acetate CAS 141758-74-9 For Ovulation& Endmometriosis , treat endmometriosis. Detailed Product Description Product Name Exenatide Acetate (Exendin... 2015-11-06
Shenzhen Simeiquan Biotechnology Co., Ltd.
Lysipressin Acetate Cas No.: 50-57-7 treatment of GH deficiency.,Peptide Human Growth Hormone Detailed Product Description Product Name Lypressin Apperance: White powder CAS NO.: ... 2015-11-03
Guangzhou Quanao Chemical Co.,Ltd
Pharmaceutical human Building Growth Hormone Peptide TB-500 for Anti-Inflammatory & heathy muscle bodybuilding Specifications of TB-500: Unit Size 2 mg/vial Unit Quantity 10 Vials ... 2016-10-27
HongKong Shijingu Technology Co.,Ltd
Detailed Product Description Getropin human growth hormones natural bodybuilding supplements greater cardiac output Quick Detail: Brand Name: human growth hormones Place of Origin: ... 2017-01-21
Hugeraw Health Technology Co.,Ltd
Products Details Current Position: Home > Products > Products Details Product Name: Human Growth Hormone Appearance:: white powder Message Online Product Introduction Product ... 2017-01-18
Shaanxi wuzhiyuan biological technology co., LTD

Send me the latesr Product Alerts for pharmaceutical human growth hormone


(no SPAM - We would not sell or share your e-mail address.)
Inquiry Cart 0