Products Companies Industry News Selling leads Inquiries UC Center
Home > Chemicals > Other Chemical Auxiliaries >

pharmaceutical human growth hormone

Refine Search

Business Type

Region

Quality Control

pharmaceutical human growth hormone

Found 2478 pharmaceutical human growth hormone for sale from different pharmaceutical human growth hormone manufacturers, This page shows 1 - 21 pharmaceutical human growth hormone products.
Trenbolone Enanthate Cutting Cycle Steroid Raw Powders For Muscle Growth 472-61-546 Trenbolone Enanthate Alias: Revalor-H CAS No: 472-61-546 Einecs No: 233-432-5 MF: C20H24O3 MW: ... 2016-11-21
Steroidraws Health Tech Company Limited Verified Supplier  Supplier capability assessment
Pharmaceutical Human Growth Hormone Peptide Powder High Purity PEG - MGF 1. Product details: Alias: PEG-Suc-YQPPSTNKNTKSQ(d)R(d)RKGSTFEEHK-NH2; M.F.: C121H200N42O39 Purity (HPLC): ... 2017-01-20
Yihan Industrial Co.,Ltd. Verified Supplier  Supplier capability assessment
CAS 158861-67-7 Pralmorelin Muscle Building Peptides , Human Growth Hormone For Weight Loss Description GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide ... 2017-02-07
Wuhan Lianshangwang Technology Co.,LTD Verified Supplier  Supplier capability assessment
Pharmaceutical Mass Building Supplements HGH Human Growth Hormone Generics 191aa(Jin hgh) 10iu vial Quick Details: Product name: Human Growth Hormone Trade name: Generics 191aa ... 2015-08-05
USPSTAR Technology Co.,Limited Verified Supplier  Supplier capability assessment
Sermorelin Acetate SARMs Steroids For Anti Aging Human Growth Hormone Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser... 2016-12-09
Wuhan Yuancheng Technology Development Co., Ltd. Verified Supplier  Supplier capability assessment
Body Building Human Growth Hormone Steroid HCG 99.5% Purity Applications: Body building Anti-aging Fat loss Get taller Specifications: Brand Name: human growth hormones Place of ... 2015-10-20
Zhuhai jiacheng Sci. & Tech. Co., Ltd Verified Supplier  Supplier capability assessment
Polypeptide Hormones Fragment 176-191 of HGH/ Human Growth Hormone for fat burning Notice: We do not sell finished polypeptide, HGH and HGH Fragment 176-191 is diffierent product, ... 2016-07-14
Zhuhaishi Shuangbojie Technology Co.,ltd Verified Supplier  Supplier capability assessment
Getropin human growth hormones natural bodybuilding supplements greater cardiac output Quick Detail: Brand Name: human growth hormones Place of Origin: China Purity : 99.5% Color : ... 2016-05-12
HongKong Amgen Biopharm CO.,LTD Verified Supplier  Supplier capability assessment
Pharmaceutical Grade Jintropin HGH Kigtropin HGH Hygetropin HGH Somatropin HGH Human Growth Hormone Warehouse in USA Specification: Product name HGH Human Growth Hormone Form & ... 2016-11-29
Shenzhen Ghormone Biotech Co.,Ltd Verified Supplier  Supplier capability assessment
GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 CJC-1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl... 2016-11-16
Jinan  Jia  Ge  Biological  Technology  Co., Ltd. Verified Supplier  Supplier capability assessment
Potent GeneScience Recombinant Human Growth Hormones 100 iu Somatropin Jintropin Product Details: Jintropin is one of the most potent recombinant Human Growth Hormones on the ... 2016-08-29
Hubei Holy Biological Co., Ltd. Verified Supplier  Supplier capability assessment
GHRP-6 Human Growth Hormone Somatropin With Secretagogue / Ghrelin Mimetic Brief info: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 ... 2016-11-16
Zhuhaishi Shuangbojie Technology Co.,ltd Verified Supplier  Supplier capability assessment
Fat Loss Peptide White Human Growth Hormone Powder HGH Fragment 176-191 2mg/Vial Quick Detail: HGH fragment 176-191 Synonyms:HGH Fragment 176-191 MF: C78H123N23O23S2 MW: 1815.08152 ... 2016-12-23
Shanghai Shucan Industrial Co.,Ltd Verified Supplier  Supplier capability assessment
Human Growth Hormone Peptides Cosyntropin Tetracosactide CAS 16960-16-0 Quick Details: * Product name: Cosyntropin/ Tetracosactide * Synonyms: Cosyntropin/ Tetracosactide * CAS No.... 2016-11-08
Wuhan Yuancheng Technology Development Co., Ltd. Verified Supplier  Supplier capability assessment
CAS 1255-49-8 Phenylpropionate Steroids Testosterone Testolent Human Growth Hormone 1.Quick Detail: 1: Alias: Retandrol 2:Manufacturer :NJBN STEROIDS 3.Assay:98%min 4.Package... 2016-11-11
Nanjing Bangnuo Biotechnology Co., Ltd Verified Supplier  Supplier capability assessment
Muscle Building Steroids Testosterone Undecanoate 98% CAS 5949-44-0 for muscle building and human growth hormone Email:matthew@pharm-china.com 1. Basic Info: CAS No.: 5949-44-0 M.F... 2015-11-27
Shanghai Yijing Pharmaceutical Co.,Ltd Verified Supplier  Supplier capability assessment
Anabolic HGH 100iu Natural Human Growth Hormone Steroid For Bodybuilding Which color is the best? Answer: When HGH is referred to by the color of the vial caps it's usually generic ... 2015-11-03
HongKong Biosuper Health Tech. Co., Ltd Verified Supplier  Supplier capability assessment
Pharmaceutical Human Growth Hormone Peptide TB-500 Anti Inflammatory Basic Information: TB500 Appearance: White powder TB500 CAS No.: 77591-33-4 TB500 Molecular Formula: C212H350N5... 2016-08-13
Please input your companyname!
98% Polypeptide Hormones Alarelin Acetate CAS 141758-74-9 For Ovulation& Endmometriosis , treat endmometriosis. Detailed Product Description Product Name Exenatide Acetate (Exendin... 2015-11-06
Shenzhen Simeiquan Biotechnology Co., Ltd.
Lysipressin Acetate Cas No.: 50-57-7 treatment of GH deficiency.,Peptide Human Growth Hormone Detailed Product Description Product Name Lypressin Apperance: White powder CAS NO.: ... 2015-11-03
Guangzhou Quanao Chemical Co.,Ltd
Pharmaceutical human Building Growth Hormone Peptide TB-500 for Anti-Inflammatory & heathy muscle bodybuilding Specifications of TB-500: Unit Size 2 mg/vial Unit Quantity 10 Vials ... 2016-10-27
HongKong Shijingu Technology Co.,Ltd

Send me the latesr Product Alerts for pharmaceutical human growth hormone


(no SPAM - We would not sell or share your e-mail address.)
Inquiry Cart 0