Sign In | Join Free | My frbiz.com
frbiz.com
Products
Search by Category
Home > Environment >

Environment Projects

Environment Projects

All Environment Projects wholesalers & Environment Projects manufacturers come from members. We doesn't provide Environment Projects products or service, please contact them directly and verify their companies info carefully.

Total 4929 products from Environment Projects Manufactures & Suppliers
China All In One Handheld POS Terminal with 2D Barcode Scanner for Multiple Application wholesale

Brand Name:EKEMP

Model Number:P10

Place of Origin:China(Mainland)

All In One Handheld POS Terminal with 2D Barcode Scanner for Multiple Application 10.1 inch high-definition touch screen,new Android 4.2.2 operating system, brings a smooth operation and strong performance. Unique bar code scanning and printing technology...

EKEMP INT'L LIMITED
Active Member

China Customized decorative panel in metal stainless steel screen partition for interior divider wholesale

Brand Name:Screen Partition

Model Number:stainless steel,aluminum,brass,metal

Place of Origin:china supplier metal screen

Customized decorative panel in metal stainless steel screen partition for interior divider CAD DRAWING WELCOME TO QUOTE. SCREEN PARTITION / ROOM DIVIDER/WALL PANEL/LASER CUT SCREEN 1.Material:stainless steel, carbon steel, aluminum,brass 2.finish:8k ...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member

Guangdong

China High Quality of Multifunctional Portable Super Brightness Led Flashlight Torch wholesale

Brand Name:Kingfory

Model Number:MS5

Place of Origin:CHINA

MS5 multi-functional hand-held flashlight It is a multifunctional hand-held super brightness flashlight. Through the switch on the handle, the three levels of different luminance and signal modes could be shifted conveniently and promptly. With the ...

Dongguan Sunshine Electronics Co Ltd
Active Member

Guangdong

China HITACHI EX300-1 EX300-2 EX300-3 EX300-5 gear pump pilot pump charge pump for excavator wholesale

Brand Name:Sailfish

Model Number:EX300-1 EX300-2 EX300-3 EX300-5

Place of Origin:CHINA

HITACHI EX300-1 EX300-2 EX300-3 EX300-5 gear pump pilot pump charge pump for excavator contact imfoemation:

Sailfish Machinery&Equipment co.,ltd
Site Member

Guangdong

China High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier wholesale

Brand Name:Youngshe

Model Number:high quality

Place of Origin:China

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-...

Chengdu YoungShe Chemical Co., Ltd
Active Member

Sichuan

China 10oz. Waterproof PVC Laminated Polyester Fabric wholesale

Place of Origin:Ningbo China

Brand Name:polyester fabric pvc

Model Number:KQD-E-017

PVC Laminated Cloth Available in an extensivevariety of colors,weightsrangingfrom0.1mm to 0.8mm, our PVC laminated cloth are ideal for many applications with good property. Application:Bag, Tent, Raincoat, Mattress, Inflatable and so on Property Fire ...

Ningbo KQD Plastic Tech Co., Ltd
Active Member

Zhejiang

China Underwater Camera,Seafloor Panoramic Camera,Stern Camera  VVL-SPC wholesale

Place of Origin:Weihai,China

Brand Name:VVLAI

Model Number:VVL-SPC

Seafloor Panoramic Camera VVL-SPC 1. Product Image: 2. Product Application Seafloor Panoramic Camera is widely used in the research of sea fisheryresources,sea research and seafloor observation,etc It has the below advantages: 1).Adopting stainless steel ...

Shandong Future Robot Co.,Ltd
Site Member

Shandong

China Coater & Post-Treatment Line wholesale

Categories:Mineral Water Bottle Caps

Country/Region:china

PRODUCT CENTER Coater & Post-Treatment Line :2017/8/4 Name:Coater & Post-Treatment Line Type:Coater & Post-Treatment Illustrate:CAPA: 200 Ton/M 一:Automatic Plating Barrel 一:Automatic Plating Rack Li

jf limited
ICP Remarked Supplier

China 035 Surface treatment wholesale

Categories:Mineral Water Bottle Caps

Telephone:769 33610999

Country/Region:china

Surface treatment Current Location:Home > Surface treatment 035Add Time:2017/3/7 22:25:27 Previous:MC032 Next:008 [Back to list]

DONGGUAN MENGCI METAL TECHNOLOGY CO.,LTD
ICP Remarked Supplier

China 2.0mm Low pressure twin fluid pneumatic automatic spray guns for steel cooling, steel lubrication wholesale

Brand Name:KLY

Model Number:Low pressure twin fluid pneumatic automatic spray guns

Place of Origin:CN

Pneumatic automatic spray guns Model ST-6 Medium air and liquid Spray shape flat spray , round spray Orifice size 0.5mm, 1.0mm, 1.3mm. 2.0mm Design Features: You can change pattern width by remote control during painting by controlling center air and horn...

Guangzhou cleaning-spray Equipment Co., Ltd
Active Member

Guangdong

China Casual and simple design with PU Leather Band Quartz Wrist Watch for Men wholesale

Place of Origin:Fuzhou, Fujian, China

Brand Name:Seeteng

Model Number:SW1247

Casual PU Leather Band Quartz Wrist Watch for Men A, Why Clients Choose Us? 1. Factory direct supply —— Competitive Price ! 2. Expert man-made skills —— Good Quality ! 3. Strong productivity —— On-Time Delivery ! 4. Accept OEM/ODM —— Your ...

FUZHOU SEETENG ELECTRONIC.CO.TLD
Site Member

Jiangxi

China Nissan Forklift Spare Parts Clutch Cover 30210-49200 wholesale

Brand Name:jiahang clutch

Model Number:Nissan Forklift Spare Parts Clutch Cover 30210-49200

Place of Origin:YANCHENG

Nissan Forklift Spare Parts Clutch Cover 30210-49200 Car make nissan SIZE 250X160 YEAR 72.09- OEM 30210-49200 ENGING 4P 2J 5R 4Y 1DZ ASCO NO. 30210-49200 P.C.D 250X160 TYPE LS PACK UNIT 2PCS G.W19 KG CARTON SIZE 35.5x36x21 mm 31210-10481-71 31510-32880-71...

YanCheng JIAHANG Clutch Co., Ltd.
Site Member

Jiangsu

China 5T-Faster Engine Powered Winch wholesale

Brand Name:huaertelecom

Place of Origin:China

5T-Faster Engine Powered Winch Performance and characteristics 1.Traction speed, the fastest 22m/min traction is double than the original cutter grinding; 2.Light weight, compact structure, small volume; 3.Web design more reasonable, convenient to use, ...

Hebei Huaer Trade Co.,Ltd
Active Member

China tree Climbers, wood pole climbers high quality, factory price wholesale

Brand Name:JINGANG

Model Number:E106

Place of Origin:CHINA

E105 Electric wooden pole climbers Climbing Irons, Durable Electric Wood Pole Climbing Shoes Tree Climber Size of E105 pole climber Classification of pole climbers: Climbers are mainly divided to concrete climbers and wood climbers, triangle tube climbers...

Jingang Hardware Tools Factory
Site Member

Shandong

China Hansel indoor amusement center  theme park equipment for sale  party places for kids  cheap plastic playhouses for kids wholesale

Brand Name:Hansel cheap plastic playhouses for kids

Model Number:HSIP cheap plastic playhouses for kids

Place of Origin:China cheap plastic playhouses for kids

Hansel indoor amusement center theme park equipment for sale party places for kids cheap plastic playhouses for kids Welcome to visit our website for products of indoor playground. You want a supplier that knows what kids need.We are the company you turn ...

Guangzhou Hansel Electronic Technology Co., LTD
Site Member

Guangdong

China Black oxidation treatment CNC machined part wholesale

Categories:CNC Milling Parts

Country/Region:china

Products Black oxidation treatment CNC machined part Minimum order: 1 piece Model: TH - B - 131 Brand name: TH FOB port: shenzhen or guangzhou Small order: accept Lead time: 15-25 days Payment: T/T Distribution: mainland China

Dongguan jin ma precision hardware co., LTD
ICP Remarked Supplier

China 50W LED tunnel light wholesale

Brand Name:SHIERGE

Place of Origin:CHINA

1.Power: 50W 2.Voltage: 85 to 265V AC 3.Power factor: >0.95 4.Luminous efficiency: 100-110lm/W 5.Color rendering index: >70Ra 6.Color temperature: 2700 to 7000K 7.Beam angle: 150*75°/40°/90° 8.Waterproof:IP67 9.Size:L298*W140*H138mm

Shierge Technology Co., Limited
Active Member

Guangdong

China Rex ORTIZ L216PBC diesel high pressure injector nozzle L216 PBC wholesale

Brand Name:ORTIZ

Model Number:Fuel Nozzle L216 PBC

Place of Origin:China

... Weight: 50g/pc 8 Car Engine: diesel vehicle 9 Brand Name: ORTIZ 10 Material: High-speed Steel 11 Certificate: CE , ISO9001

Zhengzhou Rex Auto Spare Parts Co.,Ltd
Site Member

Henan

China 1-81200-3650 0-33000-6000 - ISUZU Alternator 24V 35A Alternadores 6BB1 6BD1 wholesale

Place of Origin:China

Brand Name:ISUZU

Model Number:1-81200-3650 0-33000-6000

1-81200-3650 0-33000-6000 - ISUZU Alternator 24V 35A Alternadores 6BB1 6BD1 Product Name Isuzu power for 25A alternator Manufacturer Nikko Denki Manufacturer Part Number 0-33000-6000 Car manufacturer Isuzu Genuine part 1-81200-365-0 Output 24V/25A -35A ...

TWOO AUTO INDUSTRIAL LIMITED
Site Member

Guangdong

China Activated carbon filters wholesale

Categories:Car Engine Oil Filter

Telephone:0510-87878708

Country/Region:china

Company profile Focusing on the research and application of water purification, sewage treatment, water reuse projects and other fields, the company covers an area of 20000 square meters with its annual output value being more than one billion yuan. It ...

xdep company
ICP Remarked Supplier

Inquiry Cart 0